PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G36080.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 1504aa    MW: 168500 Da    PI: 8.1495
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G36080.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.43.2e-19136714193385
                       -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
               B3   33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85  
                       ++ l +ed +g++W+++++ +++s++yvltkGW++Fv+++gL++gD++vF+ +
  ONIVA02G36080.3 1367 GVLLNFEDGEGKVWRFRYSCWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSGS 1419
                       56799*********************************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF032541.9E-180107575IPR004938Xyloglucan fucosyltransferase
PfamPF032542.1E-1927821234IPR004938Xyloglucan fucosyltransferase
SMARTSM010190.005612911434IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-1613641421IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.4E-2013651435IPR015300DNA-binding pseudobarrel domain
PfamPF023622.0E-1613661419IPR003340B3 DNA binding domain
PROSITE profilePS5086311.51913701434IPR003340B3 DNA binding domain
CDDcd100171.72E-1413721416No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0036065Biological Processfucosylation
GO:0042546Biological Processcell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0008107Molecular Functiongalactoside 2-alpha-L-fucosyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1504 aa     Download sequence    Send to blast
MYYVRGAGGS WEKAESEACV HESARRRGVP MDEKRAARTP RAGARNAVNG GESGCCSEKA  60
ARWGWRAPVE VAVVGFVATL TLLVLLYGGT GSLLSFTSPR TEFVRKLAAA AASPSHGAPE  120
DTPESSTRHD DDRLLGGLLS QAFDEHSCRS RYTSSLYRRR SPFRPSTYLV ERLRRYEARH  180
KRCGPGSALF QEAVEHLRSG RNAARSECQY VVWTPFNGLG NRMLALASTF LYALLTDRVL  240
LVHAPPEFDG LFCEPFPGSS WTLPADFLIT DFDGVFTMWS PTSYKNMRQA GTISNATAEQ  300
SLPAYVFLDL IQSFTDAAFC DDDQQVLAKF NWMVIKSDVY FAAMLFLMPA YERELTQLFP  360
EKEAVFHHLA RYLFHPSNDV WGIVHRFYEA YLARADELVG LQVRVFPEMP IPFDNMYEQI  420
IRCSEQEGLL PKLGQTVVVT AANGSSVVAP STKLTSILVT SLFPDYYDRI RGVYHARPTE  480
TGEYVAVHQP SHEREQRTEA RGHNQRALAE IYLLSFCDRV VTSAVSTFGY IAHGLAGVRP  540
WVLLRPPSPV ARAEPACVRS ETVEPCLQAL PRRMCGAAEG SDIGALVPHI RHCEDVQKGV  600
KLGWPPAGRA AENEARRWGR LRRASARAAL VLCSLTMIPV VVVLHRCAVS SSWPDRVFEA  660
KHIAGAGEQA LPIETHMERS GGGGADGDEE RLPLHHGFET ERAAPWAAAE SKPPPPPRGR  720
FGRASVRAAL AVCFLAIPAV LLLQRWQAGS SPEWLFEIEP PADGDRDMQD DLPDDLTASQ  780
YIGYDKFLGG LLQEGFDEVS CRSRYQFARY HKNFTRIPSS YLLERLRRQE ALQKKCGPGT  840
KSYKQAVKLL RSSQGVNMTT DCNYLFLTVH AGLGNRMLEI ASAFLYALLT NRILLLDRYQ  900
EIGDLFCEPF PGTSWLMPSD FPLNYGEFTQ SSPESYGNMQ QNKVVGDNTD RSLAGFRPPY  960
VFLYLDGNYE FHDKLFFCED DQQFLQDVPW LIMRTDMYFI PSLFLIPSYQ DELSRLFPEK  1020
DAVFHHLARY LFHPTNSIWY SVKGYYRSYL AKANKTVGIQ IRIFEKEGIL QKNGRFPYVL  1080
EQILSCAQNE KLLPEISMKD EAEAPTATKN NQTIAVLTTS LSSWYSDQIQ KKYSEHPTVD  1140
GTRVEVYQPS HEEYQRSKNK KHNMKALAEI YLLSMTDVLI TSGFSTFGYA AQGLSGLTPW  1200
IMFRSENHAM PDPPCRRAMS IEPCFHQAPF YDCKAKRNAD LGKMVPFVRH CEDVSWGLKV  1260
VLAAKSQMGV WEAELVGKGS EIGLAITLLP LLAVFLLGEN VRLAVNDFAK AHQPAGTSDT  1320
NTSAFRRRQA QPPAGAQAAR GEALPAAADE LRRLRHRRRG HLQLCKGVLL NFEDGEGKVW  1380
RFRYSCWNSS QSYVLTKGWS RFVREKGLRA GDTIVFSGSA YGPDKLLFID CKKNNTAAAT  1440
GDEKPITSGE ATRVVRLFGM DITGGGGDCR KRERAVEMGQ EAFLMKRQCV HSTPHYTVRS  1500
AKAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A7e-251345143220115DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626866.10.0PREDICTED: probable fucosyltransferase 8 isoform X2
TrEMBLA0A0E0GDC50.0A0A0E0GDC5_ORYNI; Uncharacterized protein
STRINGBGIOSGA009100-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13260.14e-27related to ABI3/VP1 1